PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB09G21350.1
Common NameLOC102712006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 371aa    MW: 38893.6 Da    PI: 8.0866
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB09G21350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.91.9e-4050124377
                   SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
           SBP   3 qvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                   qvegC +dl+ ak y+ rhkvC +h+k p v+v+gleqrfCqqCsrfh+l efD+ek+sCrrrL +hnerrrk++
  OB09G21350.1  50 QVEGCGVDLTGAKPYYCRHKVCYTHAKEPIVVVAGLEQRFCQQCSRFHQLPEFDQEKKSCRRRLVGHNERRRKPT 124
                   9************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114129.5346123IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3150122IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.36E-3750126IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.105.3E-3050110IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MATGGSSSGG GDDVHGLKFG KKIYFEQDAA AGGSGSAAVE PSSSGGGGSQ VEGCGVDLTG  60
AKPYYCRHKV CYTHAKEPIV VVAGLEQRFC QQCSRFHQLP EFDQEKKSCR RRLVGHNERR  120
RKPTPGANSS RFGRLAPSFH EESGRSRSFV VDFSYPRVPS SVRDAWPTIQ PGDRMSGSIQ  180
WQGSHELHPH RSAVAGYGDH HAYSSHGGSS AGAPMLHHPA FELTSGGCLA GVSTDSNCAL  240
SLLSTQPWDT TQSISSHNGR SPAMSSSASA FGGGTNPVSP SVMASNYMGA SSGWGSSSRG  300
HDGARNVQLP PPHGIALSEV PPGSVHHGRH FSGELELALQ GSGPSNRPET EHGSSSGAFS  360
HSTTNAMNWS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2843122584squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0635610.0AK063561.1 Oryza sativa Japonica Group cDNA clone:001-117-F03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660773.10.0PREDICTED: squamosa promoter-binding-like protein 17
SwissprotA3C0570.0SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLJ3MYQ60.0J3MYQ6_ORYBR; Uncharacterized protein
STRINGOB09G21350.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.16e-38squamosa promoter binding protein-like 9